PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID kfl00052_0040
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Klebsormidiophyceae; Klebsormidiales; Klebsormidiaceae; Klebsormidium
Family MYB
Protein Properties Length: 705aa    MW: 76322.1 Da    PI: 5.1054
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
kfl00052_0040genomeKFGPView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding53.36.5e-17121165348
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      +WT+eEde+l  +v+ +G++tW+ I++ +  +R +kqc++rw+++l
    kfl00052_0040 121 PWTKEEDEKLSSLVQVHGTKTWAFISKQFS-NRNGKQCRERWHNHL 165
                      8*****************************.*************97 PP

2Myb_DNA-binding56.94.8e-18172214246
                      SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                        WT+eE+++l++++ q+G++ W  Ia++++ gR+++ +k++w++
    kfl00052_0040 172 VDWTPEEEQKLIQLHLQFGNR-WVEIAKHLP-GRSDNAIKNHWNS 214
                      57*******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129418.107114165IPR017930Myb domain
SMARTSM007173.4E-15118167IPR001005SANT/Myb domain
SuperFamilySSF466892.73E-31119212IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.603.0E-20121165IPR009057Homeodomain-like
CDDcd001676.43E-14121165No hitNo description
PfamPF139211.4E-16122178No hitNo description
PROSITE profilePS5129426.652166220IPR017930Myb domain
Gene3DG3DSA:1.10.10.603.6E-23166219IPR009057Homeodomain-like
SMARTSM007172.0E-17170218IPR001005SANT/Myb domain
CDDcd001674.04E-14174213No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010439Biological Processregulation of glucosinolate biosynthetic process
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 705 aa     Download sequence    Send to blast
MEKNQDGEFE TEPASEGQAP LATLNVADYL PNFKPAKSEL LQRWFRGGAL SVKGEEQEQM  60
KDKLLAFVQG DDRRGEVHSS KDDSLQGNGS LNVECEAQGE QGDRPGCKEE MDGERSSRAP  120
PWTKEEDEKL SSLVQVHGTK TWAFISKQFS NRNGKQCRER WHNHLSPGLK KVDWTPEEEQ  180
KLIQLHLQFG NRWVEIAKHL PGRSDNAIKN HWNSTARRKD EKSAKATKSD ILRNYISALR  240
DPASAAMLTE PAAEAPSANC LHWTTLQLDS SDSNPTRGIT TLRSQSTQPG SPSSPLELNA  300
TLSLAPAGMI GGLQDTPCRS AVAGALSVLP ADFMGLKGSL LNDVSGLQSL AGLETGSALE  360
KLLAMQQLQQ WQEHQRLKQQ LEHQQQQDAL LRQLYGALQE AQHAQQKAAE QAQQAQLLQR  420
FQEMQAQQKQ AEALDGGCLS LNLAQTNDLS LPLPQSDAHN NLEESWNTDN DPLQLLLGTD  480
SSPPMWNSRQ PEPPLSTVES APAFDSLSYD PPAAAHTDLL STFNFDLLSP PSNPTSGLEL  540
STPALDPQLQ IGANSNSSPL QPEAQHDFAS VLLQNPSPPP QLYSQGLGEL GEVFPTPAAG  600
QKRAREEWSG DLAQPVVKAG PRGPIQWPKD DGTNLQSRYA PGKEGTGLEG IPGERKTGGV  660
GGMYKKGNCI VLTGFIGPGP LGPPGMTAKK PAGVARPAGN LAVPA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1msf_C1e-391212196104C-Myb DNA-Binding Domain
1mse_C1e-391212196104C-Myb DNA-Binding Domain
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP5171784
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G40360.14e-37myb domain protein 115